PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00046028001
Common NameGSBRNA2T00046028001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 754aa    MW: 81078 Da    PI: 8.4832
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00046028001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.91.1e-1886136455
              G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          ++Wt+ L ++F  a+e++ G +kAtPk+il++m+ k+Lt++h++S LQkYR 
  GSBRNA2T00046028001  86 IKWTSALENEFFMAIEHI-GLHKATPKRILKFMDQKSLTRAHIASKLQKYRR 136
                          79****************.9*******************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1882140IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1183140IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1686136IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MKNEIEQESL SCGAPCFVRK PIKPNDPNNM WKHALDRRIN DGSIQDDTDG SIQDDTDGSE  60
KIQEKTSSSD PCDGDSSSKK TKRVTIKWTS ALENEFFMAI EHIGLHKATP KRILKFMDQK  120
SLTRAHIASK LQKYRRNLKR DEDQRMKDRI AMHSTFSSAD GYINPQHSYN YNTRLGNNNL  180
FNVQPGYGLG QTSFMGNNNA GLHDSLNCMN RRPTYDLSQT GSKLLPMRGN LGFQNGMLPV  240
KEEWRSIPGT SQAPRFGQYG TTSNALGMNY NPTTGTMGSN NYVGIRGDEN GDLVGLGGLR  300
VNGNGNGSFS GARVHGTGSG SLQGMSVYGN GHGSSLGGRG VHGTGNGSLE RMRVPGNGHG  360
TGNGSLGGIR VHGTGNGSLE RIRVPGNGHV TGNGHGTGNG SLGGIRIHGN NNGIRIHDTS  420
NGYGSFGGVK VHGTGNSNFS PDGIIVHGNS NSNDSLGGIR VHGTDSVGGI RVHGTDAGSV  480
VGGNVHGTSN GNGSLGVNFG MNCNFNNNNM SNHGSSTPMF PSELSSFFGN KDQSQNNLIA  540
QTGGVIPALE KPKMFSDHHD INEVFSDTNN SQFHQNQQHQ GNLAGVNVGM NWNFNNNNMS  600
NYGSSTPTFP SALSSSLGNK DQSQNNLIAQ TGGHQGNLAG VNVGMNWNFN NNDMSNHGSS  660
TPMFPSELSS FFGNKDQSQN NLIAQTGGVI PALEKPKMFS DHHDINEVFS DTNNSQFHQN  720
QIVLSWTVSH LNCRCYKLQH HHIYYLVWQL INI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00046028001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130305.10.0PREDICTED: filaggrin-2
TrEMBLA0A078GW480.0A0A078GW48_BRANA; BnaA02g33170D protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1654279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62110.11e-22G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]